SCOP 1.75: Domain d1nola3: 1nol A:380-628

Lineage for d1nola3 (1nol A:380-628)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.3: Arthropod hemocyanin, C-terminal domain [81283] (1 protein)

6. Protein Arthropod hemocyanin, C-terminal domain [49228] (2 species)
   elaborated with many loop insertions in the common fold

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries)

8. Domain d1nola3: 1nol A:380-628 [21863]
   Other proteins in same PDB: d1nola1, d1nola2
   complexed with ca, cu, no3, per

Details for d1nola3

PDB Entry: 1nol, 2.4 Å

PDB Description: oxygenated hemocyanin (subunit type ii)

PDB Compounds: (A:) hemocyanin (subunit type II)

SCOP Domain Sequences for d1nola3:

Sequence, based on SEQRES records:

>d1nola3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglnehkseycscgwpshllvpkgnikgmeyhlfvm
ltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfi
kdikikfhe

Sequence, based on observed residues (ATOM records):

>d1nola3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglseycscgwpshllvpkgnikgmeyhlfvmltdw
dkdkvsvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfh
e

Timeline for d1nola3:

• d1nola3 first appeared (with stable ids) in SCOP 1.55, called d1nol_3
  
• d1nola3 appears in SCOP 1.73
  
• d1nola3 appears in SCOPe 2.01
  
• d1nola3 appears in the current release, SCOPe 2.08