Lineage for d4a26a2 (4a26 A:125-298)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847479Species Leishmania major [TaxId:5664] [226237] (2 PDB entries)
  8. 2847481Domain d4a26a2: 4a26 A:125-298 [218628]
    Other proteins in same PDB: d4a26a1, d4a26b1
    automated match to d1a4ia1
    complexed with cl

Details for d4a26a2

PDB Entry: 4a26 (more details), 2.7 Å

PDB Description: The crystal structure of Leishmania major N5,N10- methylenetetrahydrofolate dehydrogenase/cyclohydrolase
PDB Compounds: (A:) putative c-1-tetrahydrofolate synthase, cytoplasmic

SCOPe Domain Sequences for d4a26a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a26a2 c.2.1.0 (A:125-298) automated matches {Leishmania major [TaxId: 5664]}
llpvnvgllhykgreppftpctakgvivllkrcgiemagkravvlgrsnivgapvaallm
kenatvtivhsgtstedmidylrtadiviaamgqpgyvkgewikegaavvdvgttpvpdp
srkdgyrlvgdvcfeeaaaraawispvpggvgpmtiamllentleafkaalgvs

SCOPe Domain Coordinates for d4a26a2:

Click to download the PDB-style file with coordinates for d4a26a2.
(The format of our PDB-style files is described here.)

Timeline for d4a26a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4a26a1