SCOPe 2.07: Domain d3zzzb_: 3zzz B:

Lineage for d3zzzb_ (3zzz B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)

8. Domain d3zzzb_: 3zzz B: [218624]
   automated match to d1sjra_
   protein/RNA complex; complexed with iod

Details for d3zzzb_

PDB Entry: 3zzz, 1.55 Å

PDB Description: Crystal structure of a Raver1 PRI4 peptide in complex with polypyrimidine tract binding protein RRM2

PDB Compounds: (B:) Polypyrimidine tract-binding protein 1

SCOPe Domain Sequences for d3zzzb_:

Sequence; same for both SEQRES and ATOM records:

>d3zzzb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qspvlriivenlfypvtldvlhqifskfgtvlkiitftknnqfqallqyadpvsaqhakl
sldgqniynacctlridfskltslnvkynndksrdytrpdlpsgd

Timeline for d3zzzb_:

• d3zzzb_ first appeared in SCOPe 2.03
  
• d3zzzb_ appears in SCOPe 2.06
  
• d3zzzb_ appears in the current release, SCOPe 2.08