![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein automated matches [190332] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries) |
![]() | Domain d3zzzb_: 3zzz B: [218624] automated match to d1sjra_ protein/RNA complex; complexed with iod |
PDB Entry: 3zzz (more details), 1.55 Å
SCOPe Domain Sequences for d3zzzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zzzb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qspvlriivenlfypvtldvlhqifskfgtvlkiitftknnqfqallqyadpvsaqhakl sldgqniynacctlridfskltslnvkynndksrdytrpdlpsgd
Timeline for d3zzzb_: