SCOPe 2.07: Domain d3zzya_: 3zzy A:

Lineage for d3zzya_ (3zzy A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)

8. Domain d3zzya_: 3zzy A: [218621]
   automated match to d1sjra_
   protein/RNA complex

Details for d3zzya_

PDB Entry: 3zzy, 1.4 Å

PDB Description: crystal structure of a raver1 pri3 peptide in complex with polypyrimidine tract binding protein rrm2

PDB Compounds: (A:) Polypyrimidine tract-binding protein 1

SCOPe Domain Sequences for d3zzya_:

Sequence; same for both SEQRES and ATOM records:

>d3zzya_ d.58.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qspvlriivenlfypvtldvlhqifskfgtvlkiitftknnqfqallqyadpvsaqhakl
sldgqniynacctlridfskltslnvkynndksrdytrpdlpsgds

Timeline for d3zzya_:

• d3zzya_ first appeared in SCOPe 2.03
  
• d3zzya_ appears in SCOPe 2.06
  
• d3zzya_ appears in the current release, SCOPe 2.08