SCOPe 2.03: Domain d3zzxa_: 3zzx A:

Lineage for d3zzxa_ (3zzx A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (11 species)
   not a true protein

7. Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [197071] (4 PDB entries)

8. Domain d3zzxa_: 3zzx A: [218619]
   automated match to d4aj7a_
   complexed with act, dtu, gol, so4

Details for d3zzxa_

PDB Entry: 3zzx, 1.88 Å

PDB Description: Crystallographic structure of thioredoxin from Litopenaeus vannamei

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d3zzxa_:

Sequence; same for both SEQRES and ATOM records:

>d3zzxa_ c.47.1.1 (A:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvyqvkdqedftkqlneagnklvvidfyatwcgpckmiapkleelsqsmsdvvflkvdvd
ecediaqdnqiacmptflfmkngqkldslsganydkllelveknk

Timeline for d3zzxa_:

• d3zzxa_ is new in SCOPe 2.03-stable
  
• d3zzxa_ appears in SCOPe 2.04
  
• d3zzxa_ appears in the current release, SCOPe 2.08