Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (21 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [225328] (6 PDB entries) |
Domain d3zznc2: 3zzn C:165-331 [218614] Other proteins in same PDB: d3zzna1, d3zznb1, d3zznc1, d3zznd1 automated match to d1llda2 complexed with adp; mutant |
PDB Entry: 3zzn (more details), 2.9 Å
SCOPe Domain Sequences for d3zznc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zznc2 d.162.1.0 (C:165-331) automated matches {Thermus thermophilus [TaxId: 300852]} tildtarfrallaeylrvapqsvhayvlgehgdsevlvwssaqvggvpllefaeargral spedraridegvrraayriiegkgatyygigaglarlvrailtdekgvytvsaftpevag vlevslslprilgaggvagtvypslspeeraalrrsaeilkeaafalgf
Timeline for d3zznc2: