SCOPe 2.06: Domain d1llaa3: 1lla A:380-628

Lineage for d1llaa3 (1lla A:380-628)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.3: Arthropod hemocyanin, C-terminal domain [81283] (1 protein)
   automatically mapped to Pfam PF03723

6. Protein Arthropod hemocyanin, C-terminal domain [49228] (2 species)
   elaborated with many loop insertions in the common fold

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [49229] (4 PDB entries)

8. Domain d1llaa3: 1lla A:380-628 [21861]
   Other proteins in same PDB: d1llaa1, d1llaa2
   complexed with cl, cu, na

Details for d1llaa3

PDB Entry: 1lla, 2.18 Å

PDB Description: crystal structure of deoxygenated limulus polyphemus subunit ii hemocyanin at 2.18 angstroms resolution: clues for a mechanism for allosteric regulation

PDB Compounds: (A:) hemocyanin (subunit type II)

SCOPe Domain Sequences for d1llaa3:

Sequence, based on SEQRES records:

>d1llaa3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglnehkseycscgwpshllvpkgnikgmeyhlfvm
ltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfi
kdikikfhe

Sequence, based on observed residues (ATOM records):

>d1llaa3 b.1.18.3 (A:380-628) Arthropod hemocyanin, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
pydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhginpgnarsikaryyhldhe
pfsyavnvqnnsasdkhatvriflapkydelgneikadelrrtaieldkfktdlhpgknt
vvrhsldssvtlshqptfedllhgvglseycscgwpshllvpkgnikgmeyhlfvmltdw
dkdkvsvacvdavsycgardhkypdkkpmgfpfdrpihtehisdfltnnmfikdikikfh
e

Timeline for d1llaa3:

• d1llaa3 first appeared (with stable ids) in SCOP 1.55, called d1lla_3
  
• d1llaa3 appears in SCOPe 2.05
  
• d1llaa3 appears in SCOPe 2.07
  
• d1llaa3 appears in the current release, SCOPe 2.08