Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.0: automated matches [191466] (1 protein) not a true family |
Protein automated matches [190728] (15 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226376] (3 PDB entries) |
Domain d3zzgc_: 3zzg C: [218603] automated match to d2btya1 |
PDB Entry: 3zzg (more details), 2.95 Å
SCOPe Domain Sequences for d3zzgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zzgc_ c.73.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ngfsatrstviqllnnistkreveqylkyftsvsqqqfavikvggaiisdnlhelascla flyhvglypivlhgtgpqvngrleaqgiepdyidgiritdehtmavvrkcfleqnlklvt aleqlgvrarpitsgvftadyldkdkyklvgniksvtkepieasikagalpiltslaeta sgqmlnvnadvaagelarvfeplkivylnekggiingstgekisminldeeyddlmkqsw vkygtklkireikelldylprsssvaiinvqdlqkelftdsgagtmirrgy
Timeline for d3zzgc_: