SCOPe 2.03: Domain d3zzga_: 3zzg A:

Lineage for d3zzga_ (3zzg A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (13 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226376] (3 PDB entries)

8. Domain d3zzga_: 3zzg A: [218601]
   automated match to d2btya1

Details for d3zzga_

PDB Entry: 3zzg, 2.95 Å

PDB Description: Crystal structure of the amino acid kinase domain from Saccharomyces cerevisiae acetylglutamate kinase without ligands

PDB Compounds: (A:) acetylglutamate kinase

SCOPe Domain Sequences for d3zzga_:

Sequence; same for both SEQRES and ATOM records:

>d3zzga_ c.73.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ngfsatrstviqllnnistkreveqylkyftsvsqqqfavikvggaiisdnlhelascla
flyhvglypivlhgtgpqvngrleaqgiepdyidgiritdehtmavvrkcfleqnlklvt
aleqlgvrarpitsgvftadyldkdkyklvgniksvtkepieasikagalpiltslaeta
sgqmlnvnadvaagelarvfeplkivylnekggiingstgekisminldeeyddlmkqsw
vkygtklkireikelldylprsssvaiinvqdlqkelftdsgagtmirrgy

Timeline for d3zzga_:

• d3zzga_ is new in SCOPe 2.03-stable
  
• d3zzga_ appears in SCOPe 2.04
  
• d3zzga_ appears in the current release, SCOPe 2.08