SCOPe 2.06: Domain d3zzfb_: 3zzf B:

Lineage for d3zzfb_ (3zzf B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (15 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226376] (3 PDB entries)

8. Domain d3zzfb_: 3zzf B: [218598]
   automated match to d2btya1
   complexed with cl, edo, gol, hg, nlg

Details for d3zzfb_

PDB Entry: 3zzf, 2.2 Å

PDB Description: Crystal structure of the amino acid kinase domain from Saccharomyces cerevisiae acetylglutamate kinase complexed with its substrate N- acetylglutamate

PDB Compounds: (B:) acetylglutamate kinase

SCOPe Domain Sequences for d3zzfb_:

Sequence; same for both SEQRES and ATOM records:

>d3zzfb_ c.73.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gfsatrstviqllnnistkreveqylkyftsvsqqqfavikvggaiisdnlhelasclaf
lyhvglypivlhgtgpqvngrleaqgiepdyidgiritdehtmavvrkcfleqnlklvta
leqlgvrarpitsgvftadyldkdkyklvgniksvtkepieasikagalpiltslaetas
gqmlnvnadvaagelarvfeplkivylnekggiingstgekisminldeeyddlmkqswv
kygtklkireikelldylprsssvaiinvqdlqkelftdsgagtmirrg

Timeline for d3zzfb_:

• d3zzfb_ first appeared in SCOPe 2.03
  
• d3zzfb_ appears in SCOPe 2.05
  
• d3zzfb_ appears in SCOPe 2.07
  
• d3zzfb_ appears in the current release, SCOPe 2.08