Lineage for d3zzfb_ (3zzf B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905281Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 2905282Protein automated matches [190728] (15 species)
    not a true protein
  7. 2905360Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226376] (3 PDB entries)
  8. 2905366Domain d3zzfb_: 3zzf B: [218598]
    automated match to d2btya1
    complexed with cl, edo, gol, hg, nlg

Details for d3zzfb_

PDB Entry: 3zzf (more details), 2.2 Å

PDB Description: Crystal structure of the amino acid kinase domain from Saccharomyces cerevisiae acetylglutamate kinase complexed with its substrate N- acetylglutamate
PDB Compounds: (B:) acetylglutamate kinase

SCOPe Domain Sequences for d3zzfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zzfb_ c.73.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gfsatrstviqllnnistkreveqylkyftsvsqqqfavikvggaiisdnlhelasclaf
lyhvglypivlhgtgpqvngrleaqgiepdyidgiritdehtmavvrkcfleqnlklvta
leqlgvrarpitsgvftadyldkdkyklvgniksvtkepieasikagalpiltslaetas
gqmlnvnadvaagelarvfeplkivylnekggiingstgekisminldeeyddlmkqswv
kygtklkireikelldylprsssvaiinvqdlqkelftdsgagtmirrg

SCOPe Domain Coordinates for d3zzfb_:

Click to download the PDB-style file with coordinates for d3zzfb_.
(The format of our PDB-style files is described here.)

Timeline for d3zzfb_: