![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
![]() | Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) ![]() the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
![]() | Family c.73.1.0: automated matches [191466] (1 protein) not a true family |
![]() | Protein automated matches [190728] (15 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226376] (3 PDB entries) |
![]() | Domain d3zzfa_: 3zzf A: [218597] automated match to d2btya1 complexed with cl, edo, gol, hg, nlg |
PDB Entry: 3zzf (more details), 2.2 Å
SCOPe Domain Sequences for d3zzfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zzfa_ c.73.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ngfsatrstviqllnnistkreveqylkyftsvsqqqfavikvggaiisdnlhelascla flyhvglypivlhgtgpqvngrleaqgiepdyidgiritdehtmavvrkcfleqnlklvt aleqlgvrarpitsgvftadyldkdkyklvgniksvtkepieasikagalpiltslaeta sgqmlnvnadvaagelarvfeplkivylnekggiingstgekisminldeeyddlmkqsw vkygtklkireikelldylprsssvaiinvqdlqkelftdsgagtmirrgy
Timeline for d3zzfa_: