Lineage for d3zz6a1 (3zz6 A:1-180)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066547Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2066750Protein automated matches [190384] (19 species)
    not a true protein
  7. 2066788Species Human coxsackievirus B3 [TaxId:12072] [188738] (7 PDB entries)
  8. 2066797Domain d3zz6a1: 3zz6 A:1-180 [218594]
    Other proteins in same PDB: d3zz6a2
    automated match to d3zzba_
    complexed with g75

Details for d3zz6a1

PDB Entry: 3zz6 (more details), 2.05 Å

PDB Description: crystal structure of 3c protease of coxsackievirus b3 complexed with michael receptor inhibitor 75
PDB Compounds: (A:) polyprotein 3bcd

SCOPe Domain Sequences for d3zz6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zz6a1 b.47.1.4 (A:1-180) automated matches {Human coxsackievirus B3 [TaxId: 12072]}
gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
elvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt
eygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn

SCOPe Domain Coordinates for d3zz6a1:

Click to download the PDB-style file with coordinates for d3zz6a1.
(The format of our PDB-style files is described here.)

Timeline for d3zz6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zz6a2