SCOPe 2.06: Domain d3zz5a1: 3zz5 A:1-180

Lineage for d3zz5a1 (3zz5 A:1-180)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (19 species)
   not a true protein

7. Species Human coxsackievirus [TaxId:12072] [188739] (11 PDB entries)

8. Domain d3zz5a1: 3zz5 A:1-180 [218593]
   Other proteins in same PDB: d3zz5a2
   automated match to d3zzba_
   complexed with g74

Details for d3zz5a1

PDB Entry: 3zz5, 2.2 Å

PDB Description: crystal structure of 3c protease of coxsackievirus b3 complexed with alpha, beta-unsaturated ethyl ester inhibitor 74

PDB Compounds: (A:) 3C proteinase

SCOPe Domain Sequences for d3zz5a1:

Sequence; same for both SEQRES and ATOM records:

>d3zz5a1 b.47.1.4 (A:1-180) automated matches {Human coxsackievirus [TaxId: 12072]}
gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
elvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt
eygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn

Timeline for d3zz5a1:

• d3zz5a1 first appeared in SCOPe 2.03, called d3zz5a_
  
• d3zz5a1 was called d3zz5a_ in SCOPe 2.05
  
• d3zz5a1 appears in SCOPe 2.07
  
• d3zz5a1 appears in the current release, SCOPe 2.08