Lineage for d3zylb2 (3zyl B:149-264)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696791Superfamily a.7.8: GAT-like domain [89009] (3 families) (S)
  5. 2696828Family a.7.8.0: automated matches [227302] (1 protein)
    not a true family
  6. 2696829Protein automated matches [227128] (1 species)
    not a true protein
  7. 2696830Species Norway rat (Rattus norvegicus) [TaxId:10116] [226791] (2 PDB entries)
  8. 2696832Domain d3zylb2: 3zyl B:149-264 [218590]
    Other proteins in same PDB: d3zyla1, d3zylb1
    automated match to d1hx8a1

Details for d3zylb2

PDB Entry: 3zyl (more details), 1.7 Å

PDB Description: structure of a truncated calm (picalm) anth domain
PDB Compounds: (B:) phosphatidylinositol-binding clathrin assembly protein

SCOPe Domain Sequences for d3zylb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zylb2 a.7.8.0 (B:149-264) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
krgadgvmrtmntekllktvpiiqnqmdalldfnvnsneltngvinaafmllfkdairlf
aaynegiinllekyfdmkknqckegldiykkfltrmtriseflkvaeqvgidrgdi

SCOPe Domain Coordinates for d3zylb2:

Click to download the PDB-style file with coordinates for d3zylb2.
(The format of our PDB-style files is described here.)

Timeline for d3zylb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zylb1