Lineage for d1ehaa1 (1eha A:1-90)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658673Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 658810Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species)
    domain architecture similar to isoamylase
  7. 658811Species Archaeon Sulfolobus solfataricus, km1 [TaxId:2287] [49225] (2 PDB entries)
  8. 658813Domain d1ehaa1: 1eha A:1-90 [21859]
    Other proteins in same PDB: d1ehaa2, d1ehaa3
    mutant

Details for d1ehaa1

PDB Entry: 1eha (more details), 3 Å

PDB Description: crystal structure of glycosyltrehalose trehalohydrolase from sulfolobus solfataricus
PDB Compounds: (A:) glycosyltrehalose trehalohydrolase

SCOP Domain Sequences for d1ehaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehaa1 b.1.18.2 (A:1-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]}
tfaykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvl
ddaseipdpasryqpegvhgpsqiiqeske

SCOP Domain Coordinates for d1ehaa1:

Click to download the PDB-style file with coordinates for d1ehaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ehaa1: