SCOP 1.61: Domain d1ehaa1: 1eha A:1-90

Lineage for d1ehaa1 (1eha A:1-90)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (27 proteins)

6. Protein Glycosyltrehalose trehalohydrolase, N-terminal domain [49224] (1 species)

7. Species Archaeon Sulfolobus solfataricus, km1 [TaxId:2287] [49225] (2 PDB entries)

8. Domain d1ehaa1: 1eha A:1-90 [21859]
   Other proteins in same PDB: d1ehaa2, d1ehaa3

Details for d1ehaa1

PDB Entry: 1eha, 3 Å

PDB Description: crystal structure of glycosyltrehalose trehalohydrolase from sulfolobus solfataricus

SCOP Domain Sequences for d1ehaa1:

Sequence; same for both SEQRES and ATOM records:

>d1ehaa1 b.1.1.5 (A:1-90) Glycosyltrehalose trehalohydrolase, N-terminal domain {Archaeon Sulfolobus solfataricus, km1}
tfaykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvl
ddaseipdpasryqpegvhgpsqiiqeske

Timeline for d1ehaa1:

• d1ehaa1 first appeared (with stable ids) in SCOP 1.55
  
• d1ehaa1 appears in SCOP 1.59
  
• d1ehaa1 appears in SCOP 1.63
  
• d1ehaa1 appears in the current release, SCOPe 2.08