SCOPe 2.08: Domain d3zyla2: 3zyl A:149-264

Lineage for d3zyla2 (3zyl A:149-264)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.8: GAT-like domain [89009] (3 families)

5. Family a.7.8.0: automated matches [227302] (1 protein)
   not a true family

6. Protein automated matches [227128] (1 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [226791] (2 PDB entries)

8. Domain d3zyla2: 3zyl A:149-264 [218588]
   Other proteins in same PDB: d3zyla1, d3zylb1
   automated match to d1hx8a1

Details for d3zyla2

PDB Entry: 3zyl, 1.7 Å

PDB Description: structure of a truncated calm (picalm) anth domain

PDB Compounds: (A:) phosphatidylinositol-binding clathrin assembly protein

SCOPe Domain Sequences for d3zyla2:

Sequence; same for both SEQRES and ATOM records:

>d3zyla2 a.7.8.0 (A:149-264) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
krgadgvmrtmntekllktvpiiqnqmdalldfnvnsneltngvinaafmllfkdairlf
aaynegiinllekyfdmkknqckegldiykkfltrmtriseflkvaeqvgidrgdi

Timeline for d3zyla2:

• d3zyla2 first appeared in SCOPe 2.03
  
• d3zyla2 appears in SCOPe 2.07