![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
![]() | Family a.118.9.0: automated matches [191620] (1 protein) not a true family |
![]() | Protein automated matches [191137] (5 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [226790] (2 PDB entries) |
![]() | Domain d3zyla1: 3zyl A:5-148 [218587] Other proteins in same PDB: d3zyla2, d3zylb2 automated match to d1hx8a2 |
PDB Entry: 3zyl (more details), 1.7 Å
SCOPe Domain Sequences for d3zyla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zyla1 a.118.9.0 (A:5-148) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} sltdritaaqhsvtgsavsktvckattheimgpkkkhldyliqctnemnvnipqladslf erttnsswvvvfkslitthhlmvygnerfiqylasrntlfnlsnfldksglqgydmstfi rrysrylnekavsyrqvafdftkv
Timeline for d3zyla1: