![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.8: GAT-like domain [89009] (3 families) ![]() |
![]() | Family a.7.8.0: automated matches [227302] (1 protein) not a true family |
![]() | Protein automated matches [227128] (1 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [226791] (2 PDB entries) |
![]() | Domain d3zykb2: 3zyk B:149-285 [218586] Other proteins in same PDB: d3zyka1, d3zykb1 automated match to d1hx8a1 |
PDB Entry: 3zyk (more details), 1.8 Å
SCOPe Domain Sequences for d3zykb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zykb2 a.7.8.0 (B:149-285) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} krgadgvmrtmntekllktvpiiqnqmdalldfnvnsneltngvinaafmllfkdairlf aaynegiinllekyfdmkknqckegldiykkfltrmtriseflkvaeqvgidrgdipdls qapsslldaleqhlasl
Timeline for d3zykb2: