Lineage for d3zyka1 (3zyk A:20-148)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727055Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2727164Family a.118.9.0: automated matches [191620] (1 protein)
    not a true family
  6. 2727165Protein automated matches [191137] (5 species)
    not a true protein
  7. 2727188Species Norway rat (Rattus norvegicus) [TaxId:10116] [226790] (2 PDB entries)
  8. 2727191Domain d3zyka1: 3zyk A:20-148 [218583]
    Other proteins in same PDB: d3zyka2, d3zykb2
    automated match to d1hx8a2

Details for d3zyka1

PDB Entry: 3zyk (more details), 1.8 Å

PDB Description: structure of calm (picalm) anth domain
PDB Compounds: (A:) phosphatidylinositol-binding clathrin assembly protein

SCOPe Domain Sequences for d3zyka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zyka1 a.118.9.0 (A:20-148) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
savsktvckattheimgpkkkhldyliqctnemnvnipqladslferttnsswvvvfksl
itthhlmvygnerfiqylasrntlfnlsnfldksglqgydmstfirrysrylnekavsyr
qvafdftkv

SCOPe Domain Coordinates for d3zyka1:

Click to download the PDB-style file with coordinates for d3zyka1.
(The format of our PDB-style files is described here.)

Timeline for d3zyka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zyka2