![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species) domain architecture similar to isoamylase |
![]() | Species Archaeon Sulfolobus solfataricus, km1 [TaxId:2287] [49225] (2 PDB entries) |
![]() | Domain d1eh9a1: 1eh9 A:1-90 [21858] Other proteins in same PDB: d1eh9a2, d1eh9a3 |
PDB Entry: 1eh9 (more details), 3 Å
SCOP Domain Sequences for d1eh9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eh9a1 b.1.18.2 (A:1-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} tfaykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvl ddaseipdpasryqpegvhgpsqiiqeske
Timeline for d1eh9a1: