![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
![]() | Family d.128.1.0: automated matches [227250] (1 protein) not a true family |
![]() | Protein automated matches [227028] (6 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [226759] (6 PDB entries) |
![]() | Domain d3zxve2: 3zxv E:105-478 [218579] Other proteins in same PDB: d3zxva1, d3zxvb1, d3zxvc1, d3zxvd1, d3zxve1, d3zxvf1 automated match to d1f52a2 complexed with cl, mg, mxi, p3s, po4 |
PDB Entry: 3zxv (more details), 2.26 Å
SCOPe Domain Sequences for d3zxve2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zxve2 d.128.1.0 (E:105-478) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} srdprniarkaenylistgiadtayfgaeaefyifdsvsfdsrangsfyevdaisgwwnt gaateadgspnrgykvrhkggyfpvapndqyvdlrdkmltnlinsgfilekghhevgsgg qaeinyqfnsllhaaddmqlykyiikntawqngktvtfmpkplfgdngsgmhchqslwkd gaplmydetgyaglsdtarhyiggllhhapsllaftnptvnsykrlvpgyeapinlvysq rnrsacvripitgsnpkakrlefrspdssgnpylafsamlmagldgiknkiepqapvdkd lyelppeeaasipqtptqlsdvidrleadheylteggvftndlietwisfkreneiepvn irphpyefalyydv
Timeline for d3zxve2: