SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3zxva1 (3zxv A:4-104)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2160675Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2160800Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 2160801Protein automated matches [226862] (4 species)
    not a true protein
  7. 2160870Species Mycobacterium tuberculosis [TaxId:83332] [224991] (6 PDB entries)
  8. 2160883Domain d3zxva1: 3zxv A:4-104 [218570]
    Other proteins in same PDB: d3zxva2, d3zxvb2, d3zxvc2, d3zxvd2, d3zxve2, d3zxvf2
    automated match to d1f52a1
    complexed with cl, mg, mxi, p3s, po4

Details for d3zxva1

PDB Entry: 3zxv (more details), 2.26 Å

PDB Description: Crystal structure of Mycobacterium Tuberculosis Glutamine Synthetase in complex with tri-substituted imidazole inhibitor (4-(2-tert-butyl- 4-(6-methoxynaphthalen-2-yl)-1H-imidazol-5-yl)pyridin-2-amine) and L- methionine-S-sulfoximine phosphate
PDB Compounds: (A:) glutamine synthetase 1

SCOPe Domain Sequences for d3zxva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zxva1 d.15.9.0 (A:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
ihesdmlllpdpetaridpfraaktlninffvhdpftlepy

SCOPe Domain Coordinates for d3zxva1:

Click to download the PDB-style file with coordinates for d3zxva1.
(The format of our PDB-style files is described here.)

Timeline for d3zxva1: