SCOP 1.65: Domain d1bvzb1: 1bvz B:1-120

Lineage for d1bvzb1 (1bvz B:1-120)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (7 PDB entries)

8. Domain d1bvzb1: 1bvz B:1-120 [21857]
   Other proteins in same PDB: d1bvza2, d1bvza3, d1bvzb2, d1bvzb3

Details for d1bvzb1

PDB Entry: 1bvz, 2.6 Å

PDB Description: alpha-amylase ii (tvaii) from thermoactinomyces vulgaris r-47

SCOP Domain Sequences for d1bvzb1:

Sequence; same for both SEQRES and ATOM records:

>d1bvzb1 b.1.18.2 (B:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

Timeline for d1bvzb1:

• d1bvzb1 first appeared (with stable ids) in SCOP 1.55
  
• d1bvzb1 appears in SCOP 1.63
  
• d1bvzb1 appears in SCOP 1.67
  
• d1bvzb1 appears in the current release, SCOPe 2.08