Lineage for d1bvzb1 (1bvz B:1-120)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160787Protein Maltogenic amylase, N-terminal domain [49221] (4 species)
  7. 160794Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (7 PDB entries)
  8. 160798Domain d1bvzb1: 1bvz B:1-120 [21857]
    Other proteins in same PDB: d1bvza2, d1bvza3, d1bvzb2, d1bvzb3

Details for d1bvzb1

PDB Entry: 1bvz (more details), 2.6 Å

PDB Description: alpha-amylase ii (tvaii) from thermoactinomyces vulgaris r-47
PDB Compounds: (B:)

SCOP Domain Sequences for d1bvzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvzb1 b.1.1.5 (B:1-120) Maltogenic amylase, N-terminal domain {Thermoactinomyces vulgaris, TVAII}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOP Domain Coordinates for d1bvzb1:

Click to download the PDB-style file with coordinates for d1bvzb1.
(The format of our PDB-style files is described here.)

Timeline for d1bvzb1: