SCOP 1.55: Domain d1bvzb1: 1bvz B:1-120

Lineage for d1bvzb1 (1bvz B:1-120)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.5: E set domains [49208] (23 proteins)

6. Protein Maltogenic amylase, N-terminal domain [49221] (2 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (1 PDB entry)

8. Domain d1bvzb1: 1bvz B:1-120 [21857]
   Other proteins in same PDB: d1bvza2, d1bvza3, d1bvzb2, d1bvzb3

Details for d1bvzb1

PDB Entry: 1bvz, 2.6 Å

PDB Description: alpha-amylase ii (tvaii) from thermoactinomyces vulgaris r-47

SCOP Domain Sequences for d1bvzb1:

Sequence; same for both SEQRES and ATOM records:

>d1bvzb1 b.1.1.5 (B:1-120) Maltogenic amylase, N-terminal domain {Thermoactinomyces vulgaris, TVAII}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

Timeline for d1bvzb1:

• d1bvzb1 appears in SCOP 1.57
  
• d1bvzb1 appears in the current release, SCOPe 2.08