Lineage for d3zxrf1 (3zxr F:4-104)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934813Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2934938Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 2934939Protein automated matches [226862] (5 species)
    not a true protein
  7. 2935027Species Mycobacterium tuberculosis [TaxId:83332] [224991] (6 PDB entries)
  8. 2935045Domain d3zxrf1: 3zxr F:4-104 [218568]
    Other proteins in same PDB: d3zxra2, d3zxrb2, d3zxrc2, d3zxrd2, d3zxre2, d3zxrf2
    automated match to d1f52a1
    complexed with cl, iq1, mg, p3s, po4

Details for d3zxrf1

PDB Entry: 3zxr (more details), 2.15 Å

PDB Description: crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (3-(2-tert-butyl- 5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline) and l-methionine-s- sulfoximine phosphate.
PDB Compounds: (F:) glutamine synthetase 1

SCOPe Domain Sequences for d3zxrf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zxrf1 d.15.9.0 (F:4-104) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ktpddvfklakdekveyvdvrfcdlpgimqhftipasafdksvfddglafdgssirgfqs
ihesdmlllpdpetaridpfraaktlninffvhdpftlepy

SCOPe Domain Coordinates for d3zxrf1:

Click to download the PDB-style file with coordinates for d3zxrf1.
(The format of our PDB-style files is described here.)

Timeline for d3zxrf1: