Lineage for d1bvza1 (1bvz A:1-120)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9706Protein Maltogenic amylase, N-terminal domain [49221] (2 species)
  7. 9707Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (1 PDB entry)
  8. 9708Domain d1bvza1: 1bvz A:1-120 [21856]
    Other proteins in same PDB: d1bvza2, d1bvza3, d1bvzb2, d1bvzb3

Details for d1bvza1

PDB Entry: 1bvz (more details), 2.6 Å

PDB Description: alpha-amylase ii (tvaii) from thermoactinomyces vulgaris r-47

SCOP Domain Sequences for d1bvza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvza1 b.1.1.5 (A:1-120) Maltogenic amylase, N-terminal domain {Thermoactinomyces vulgaris, TVAII}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOP Domain Coordinates for d1bvza1:

Click to download the PDB-style file with coordinates for d1bvza1.
(The format of our PDB-style files is described here.)

Timeline for d1bvza1: