Lineage for d1smab1 (1sma B:1-123)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9706Protein Maltogenic amylase, N-terminal domain [49221] (2 species)
  7. 9710Species Thermus sp. [TaxId:275] [49222] (1 PDB entry)
  8. 9712Domain d1smab1: 1sma B:1-123 [21855]
    Other proteins in same PDB: d1smaa2, d1smaa3, d1smab2, d1smab3

Details for d1smab1

PDB Entry: 1sma (more details), 2.8 Å

PDB Description: crystal structure of a maltogenic amylase

SCOP Domain Sequences for d1smab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smab1 b.1.1.5 (B:1-123) Maltogenic amylase, N-terminal domain {Thermus sp.}
mrkeaihhrstdnfayaydsetlhlrlqtkkndvdhvellfgdpyewhdgawqfqtmpmr
ktgsdglfdywlaevkppyrrlrygfvlraggeklvytekgfyheapsddtayyfcfpfl
hrv

SCOP Domain Coordinates for d1smab1:

Click to download the PDB-style file with coordinates for d1smab1.
(The format of our PDB-style files is described here.)

Timeline for d1smab1: