Lineage for d3zvib1 (3zvi B:1-160)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905465Species Clostridium tetanomorphum [TaxId:1553] [226375] (2 PDB entries)
  8. 1905467Domain d3zvib1: 3zvi B:1-160 [218541]
    Other proteins in same PDB: d3zvia2, d3zvib2
    automated match to d1kkoa2
    complexed with cl, gol, mg, rop; mutant

Details for d3zvib1

PDB Entry: 3zvi (more details), 1.9 Å

PDB Description: methylaspartate ammonia lyase from clostridium tetanomorphum mutant l384a
PDB Compounds: (B:) methylaspartate ammonia-lyase

SCOPe Domain Sequences for d3zvib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zvib1 d.54.1.0 (B:1-160) automated matches {Clostridium tetanomorphum [TaxId: 1553]}
mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
dgqvahgdcaavqysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
vngnrlhtairygitqaildavaktrkvtmaevirdeynp

SCOPe Domain Coordinates for d3zvib1:

Click to download the PDB-style file with coordinates for d3zvib1.
(The format of our PDB-style files is described here.)

Timeline for d3zvib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zvib2