Lineage for d1smaa1 (1sma A:1-123)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658673Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 658832Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 658880Species Thermus sp. [TaxId:275] [49222] (2 PDB entries)
  8. 658883Domain d1smaa1: 1sma A:1-123 [21854]
    Other proteins in same PDB: d1smaa2, d1smaa3, d1smab2, d1smab3

Details for d1smaa1

PDB Entry: 1sma (more details), 2.8 Å

PDB Description: crystal structure of a maltogenic amylase
PDB Compounds: (A:) maltogenic amylase

SCOP Domain Sequences for d1smaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smaa1 b.1.18.2 (A:1-123) Maltogenic amylase, N-terminal domain N {Thermus sp. [TaxId: 275]}
mrkeaihhrstdnfayaydsetlhlrlqtkkndvdhvellfgdpyewhdgawqfqtmpmr
ktgsdglfdywlaevkppyrrlrygfvlraggeklvytekgfyheapsddtayyfcfpfl
hrv

SCOP Domain Coordinates for d1smaa1:

Click to download the PDB-style file with coordinates for d1smaa1.
(The format of our PDB-style files is described here.)

Timeline for d1smaa1: