SCOP 1.57: Domain d1smaa1: 1sma A:1-123

Lineage for d1smaa1 (1sma A:1-123)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.5: E set domains [49208] (24 proteins)

6. Protein Maltogenic amylase, N-terminal domain [49221] (2 species)

7. Species Thermus sp. [TaxId:275] [49222] (1 PDB entry)

8. Domain d1smaa1: 1sma A:1-123 [21854]
   Other proteins in same PDB: d1smaa2, d1smaa3, d1smab2, d1smab3

Details for d1smaa1

PDB Entry: 1sma, 2.8 Å

PDB Description: crystal structure of a maltogenic amylase

SCOP Domain Sequences for d1smaa1:

Sequence; same for both SEQRES and ATOM records:

>d1smaa1 b.1.1.5 (A:1-123) Maltogenic amylase, N-terminal domain {Thermus sp.}
mrkeaihhrstdnfayaydsetlhlrlqtkkndvdhvellfgdpyewhdgawqfqtmpmr
ktgsdglfdywlaevkppyrrlrygfvlraggeklvytekgfyheapsddtayyfcfpfl
hrv

Timeline for d1smaa1:

• d1smaa1 first appeared (with stable ids) in SCOP 1.55
  
• d1smaa1 appears in SCOP 1.59
  
• d1smaa1 appears in the current release, SCOPe 2.08