SCOPe 2.08: Domain d3zvhb2: 3zvh B:161-413

Lineage for d3zvhb2 (3zvh B:161-413)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Clostridium tetanomorphum [TaxId:1553] [226805] (2 PDB entries)

8. Domain d3zvhb2: 3zvh B:161-413 [218538]
   Other proteins in same PDB: d3zvha1, d3zvha3, d3zvhb1, d3zvhb3
   automated match to d1kkoa1
   complexed with cl, gol, mg; mutant

Details for d3zvhb2

PDB Entry: 3zvh, 1.99 Å

PDB Description: methylaspartate ammonia lyase from clostridium tetanomorphum mutant q73a

PDB Compounds: (B:) methylaspartate ammonia-lyase

SCOPe Domain Sequences for d3zvhb2:

Sequence; same for both SEQRES and ATOM records:

>d3zvhb2 c.1.11.0 (B:161-413) automated matches {Clostridium tetanomorphum [TaxId: 1553]}
gaeinavpvfaqsgddrydnvdkmiikeadvlphalinnveeklglkgeklleyvkwlrd
riiklrvredyapifhidvygtigaafdvdikamadyiqtlaeaakpfhlriegpmdved
rqkqmeamrdlraeldgrgvdaelvadewcntvedvkfftdnkaghmvqiktpdlggvnn
iadaimyckangmgaycggtcnetnrsaevttnigmacgarqvlakpgmgvdegmmivkn
emnrvlalvgrrk

Timeline for d3zvhb2:

• d3zvhb2 first appeared in SCOPe 2.03
  
• d3zvhb2 appears in SCOPe 2.07