Lineage for d3zvhb1 (3zvh B:1-160)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948147Species Clostridium tetanomorphum [TaxId:1553] [226375] (2 PDB entries)
  8. 2948151Domain d3zvhb1: 3zvh B:1-160 [218537]
    Other proteins in same PDB: d3zvha2, d3zvha3, d3zvhb2, d3zvhb3
    automated match to d1kkoa2
    complexed with cl, gol, mg; mutant

Details for d3zvhb1

PDB Entry: 3zvh (more details), 1.99 Å

PDB Description: methylaspartate ammonia lyase from clostridium tetanomorphum mutant q73a
PDB Compounds: (B:) methylaspartate ammonia-lyase

SCOPe Domain Sequences for d3zvhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zvhb1 d.54.1.0 (B:1-160) automated matches {Clostridium tetanomorphum [TaxId: 1553]}
mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
dgqvahgdcaavaysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
vngnrlhtairygitqaildavaktrkvtmaevirdeynp

SCOPe Domain Coordinates for d3zvhb1:

Click to download the PDB-style file with coordinates for d3zvhb1.
(The format of our PDB-style files is described here.)

Timeline for d3zvhb1: