Lineage for d3zvha2 (3zvh A:161-413)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837464Species Clostridium tetanomorphum [TaxId:1553] [226805] (2 PDB entries)
  8. 2837467Domain d3zvha2: 3zvh A:161-413 [218536]
    Other proteins in same PDB: d3zvha1, d3zvha3, d3zvhb1, d3zvhb3
    automated match to d1kkoa1
    complexed with cl, gol, mg; mutant

Details for d3zvha2

PDB Entry: 3zvh (more details), 1.99 Å

PDB Description: methylaspartate ammonia lyase from clostridium tetanomorphum mutant q73a
PDB Compounds: (A:) methylaspartate ammonia-lyase

SCOPe Domain Sequences for d3zvha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zvha2 c.1.11.0 (A:161-413) automated matches {Clostridium tetanomorphum [TaxId: 1553]}
gaeinavpvfaqsgddrydnvdkmiikeadvlphalinnveeklglkgeklleyvkwlrd
riiklrvredyapifhidvygtigaafdvdikamadyiqtlaeaakpfhlriegpmdved
rqkqmeamrdlraeldgrgvdaelvadewcntvedvkfftdnkaghmvqiktpdlggvnn
iadaimyckangmgaycggtcnetnrsaevttnigmacgarqvlakpgmgvdegmmivkn
emnrvlalvgrrk

SCOPe Domain Coordinates for d3zvha2:

Click to download the PDB-style file with coordinates for d3zvha2.
(The format of our PDB-style files is described here.)

Timeline for d3zvha2: