SCOPe 2.06: Domain d3zvha1: 3zvh A:1-160

Lineage for d3zvha1 (3zvh A:1-160)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Clostridium tetanomorphum [TaxId:1553] [226375] (2 PDB entries)

8. Domain d3zvha1: 3zvh A:1-160 [218535]
   Other proteins in same PDB: d3zvha2, d3zvha3, d3zvhb2, d3zvhb3
   automated match to d1kkoa2
   complexed with cl, gol, mg; mutant

Details for d3zvha1

PDB Entry: 3zvh, 1.99 Å

PDB Description: methylaspartate ammonia lyase from clostridium tetanomorphum mutant q73a

PDB Compounds: (A:) methylaspartate ammonia-lyase

SCOPe Domain Sequences for d3zvha1:

Sequence; same for both SEQRES and ATOM records:

>d3zvha1 d.54.1.0 (A:1-160) automated matches {Clostridium tetanomorphum [TaxId: 1553]}
mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
dgqvahgdcaavaysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
vngnrlhtairygitqaildavaktrkvtmaevirdeynp

Timeline for d3zvha1:

• d3zvha1 first appeared in SCOPe 2.03
  
• d3zvha1 appears in SCOPe 2.05
  
• d3zvha1 appears in SCOPe 2.07
  
• d3zvha1 appears in the current release, SCOPe 2.08