| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (55 species) not a true protein |
| Species Clostridium tetanomorphum [TaxId:1553] [226375] (2 PDB entries) |
| Domain d3zvha1: 3zvh A:1-160 [218535] Other proteins in same PDB: d3zvha2, d3zvhb2 automated match to d1kkoa2 complexed with cl, gol, mg; mutant |
PDB Entry: 3zvh (more details), 1.99 Å
SCOPe Domain Sequences for d3zvha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zvha1 d.54.1.0 (A:1-160) automated matches {Clostridium tetanomorphum [TaxId: 1553]}
mkivdvlctpgltgfyfddqraikkgaghdgftytgstvtegftqvrqkgesisvllvle
dgqvahgdcaavaysgaggrdplflakdfipviekeiapkligreitnfkpmaeefdkmt
vngnrlhtairygitqaildavaktrkvtmaevirdeynp
Timeline for d3zvha1: