Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein automated matches [190384] (19 species) not a true protein |
Species Human enterovirus [TaxId:42789] [196804] (9 PDB entries) |
Domain d3zvaa1: 3zva A:1-183 [218530] Other proteins in same PDB: d3zvaa2 automated match to d3zv9a_ complexed with g75 |
PDB Entry: 3zva (more details), 2.2 Å
SCOPe Domain Sequences for d3zvaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zvaa1 b.47.1.4 (A:1-183) automated matches {Human enterovirus [TaxId: 42789]} gpgfdfaqaimkkntvvartekgeftmlgvhdrvavipthasvgetiyindvetkvldac alrdltdtnleitivkldrnqkfrdirhflpryeddyndavlsvhtskfpnmyipvgqvt nygflnlggtpthrilmynfptragqcggvvtttgkvigihvggngaqgfaamllhsyft dtq
Timeline for d3zvaa1: