SCOPe 2.03: Domain d3zv8a_: 3zv8 A:

Lineage for d3zv8a_ (3zv8 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein automated matches [190384] (10 species)
   not a true protein

7. Species Human enterovirus [TaxId:42789] [196804] (9 PDB entries)

8. Domain d3zv8a_: 3zv8 A: [218529]
   automated match to d3zv9a_

Details for d3zv8a_

PDB Entry: 3zv8, 2.4 Å

PDB Description: crystal structure of 3c protease of enterovirus 68

PDB Compounds: (A:) 3C protease

SCOPe Domain Sequences for d3zv8a_:

Sequence; same for both SEQRES and ATOM records:

>d3zv8a_ b.47.1.4 (A:) automated matches {Human enterovirus [TaxId: 42789]}
gpgfdfaqaimkkntvvartekgeftmlgvhdrvavipthasvgetiyindvetkvldac
alrdltdtnleitivkldrnqkfrdirhflpryeddyndavlsvhtskfpnmyipvgqvt
nygflnlggtpthrilmynfptragqcggvvtttgkvigihvggngaqgfaamllhsyft
dtqkhhhhh

Timeline for d3zv8a_:

• d3zv8a_ is new in SCOPe 2.03-stable
  
• d3zv8a_ appears in SCOPe 2.04
  
• d3zv8a_ appears in the current release, SCOPe 2.08, called d3zv8a1