SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3zunj_ (3zun J:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2158221Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2158246Protein Elongin B [54246] (2 species)
  7. 2158247Species Human (Homo sapiens) [TaxId:9606] [54247] (29 PDB entries)
  8. 2158302Domain d3zunj_: 3zun J: [218525]
    Other proteins in same PDB: d3zunb_, d3zunc_, d3zune_, d3zunf_, d3zunh_, d3zuni_, d3zunk_, d3zunl_
    automated match to d1lm8b_
    complexed with gol, zun

Details for d3zunj_

PDB Entry: 3zun (more details), 2.5 Å

PDB Description: pVHL54-213-EloB-EloC complex_(2S,4R)-4-hydroxy-1-(2-(3-methylisoxazol- 5-yl)acetyl)-N-(4-nitrobenzyl)pyrrolidine-2-carboxamide bound
PDB Compounds: (J:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d3zunj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zunj_ d.15.1.1 (J:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmk

SCOPe Domain Coordinates for d3zunj_:

Click to download the PDB-style file with coordinates for d3zunj_.
(The format of our PDB-style files is described here.)

Timeline for d3zunj_: