Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
Domain d3zune_: 3zun E: [218520] Other proteins in same PDB: d3zuna_, d3zunc_, d3zund_, d3zunf_, d3zung_, d3zuni_, d3zunj_, d3zunl_ automated match to d2c9wc_ complexed with gol, zun |
PDB Entry: 3zun (more details), 2.5 Å
SCOPe Domain Sequences for d3zune_:
Sequence, based on SEQRES records: (download)
>d3zune_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d3zune_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgnevnfreipshvlskvcmyftykvrytn ssteipefpiapeialellmaanfldc
Timeline for d3zune_: