Lineage for d3zune_ (3zun E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945540Protein Elongin C [54699] (3 species)
  7. 2945543Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries)
  8. 2945674Domain d3zune_: 3zun E: [218520]
    Other proteins in same PDB: d3zuna_, d3zunc_, d3zund_, d3zunf_, d3zung_, d3zuni_, d3zunj_, d3zunl_
    automated match to d2c9wc_
    complexed with gol, zun

Details for d3zune_

PDB Entry: 3zun (more details), 2.5 Å

PDB Description: pvhl54-213-elob-eloc complex_(2s,4r)-4-hydroxy-1-(2-(3-methylisoxazol- 5-yl)acetyl)-n-(4-nitrobenzyl)pyrrolidine-2-carboxamide bound
PDB Compounds: (E:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d3zune_:

Sequence, based on SEQRES records: (download)

>d3zune_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d3zune_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgnevnfreipshvlskvcmyftykvrytn
ssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d3zune_:

Click to download the PDB-style file with coordinates for d3zune_.
(The format of our PDB-style files is described here.)

Timeline for d3zune_: