SCOPe 2.05: Domain d1ciua1: 1ciu A:496-578

Lineage for d1ciua1 (1ciu A:496-578)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species)
   follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases

7. Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49220] (4 PDB entries)

8. Domain d1ciua1: 1ciu A:496-578 [21852]
   Other proteins in same PDB: d1ciua2, d1ciua3, d1ciua4
   complexed with ca

Details for d1ciua1

PDB Entry: 1ciu, 2.3 Å

PDB Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1ciua1:

Sequence; same for both SEQRES and ATOM records:

>d1ciua1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
snsplighvgptmtkagqtitidgrgfgttsgqvlfgstagtivswddtevkvkvpsvtp
gkynislktssgatsntynnini

Timeline for d1ciua1:

• d1ciua1 first appeared (with stable ids) in SCOP 1.55, called d1ciu_1
  
• d1ciua1 appears in SCOPe 2.04
  
• d1ciua1 appears in SCOPe 2.06
  
• d1ciua1 appears in the current release, SCOPe 2.08