Lineage for d1ciu_1 (1ciu 496-578)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (23 proteins) 
Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species) 
Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49220] (2 PDB entries) 
Domain d1ciu_1: 1ciu 496-578 [21852]
Other proteins in same PDB: d1ciu_2, d1ciu_3, d1ciu_4
Details for d1ciu_1
PDB Entry: 1ciu (more details), 2.3 Å
PDB Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.
SCOP Domain Sequences for d1ciu_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ciu_1 b.1.1.5 (496-578) Cyclodextrin glycosyltransferase, domain E {Thermoanaerobacterium thermosulfurigenes, EM1}
snsplighvgptmtkagqtitidgrgfgttsgqvlfgstagtivswddtevkvkvpsvtp
gkynislktssgatsntynnini
SCOP Domain Coordinates for d1ciu_1:
Click to download the PDB-style file with coordinates for d1ciu_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ciu_1:
- d1ciu_1 appears in SCOP 1.57
- d1ciu_1 appears in the current release, SCOPe 2.08, called d1ciua1
View in 3D
