| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
| Protein Cyclomaltodextrin glycanotransferase, domain D [49215] (4 species) follows the starch-binding domain C; the catalytic domain A has (beta/alpha)8-barrel fold; family 13 glycosyl hydrolases |
| Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [49220] (4 PDB entries) |
| Domain d1ciua1: 1ciu A:496-578 [21852] Other proteins in same PDB: d1ciua2, d1ciua3, d1ciua4 complexed with ca has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ciu (more details), 2.3 Å
SCOPe Domain Sequences for d1ciua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ciua1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
snsplighvgptmtkagqtitidgrgfgttsgqvlfgstagtivswddtevkvkvpsvtp
gkynislktssgatsntynnini
Timeline for d1ciua1: