Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
Protein automated matches [191087] (7 species) not a true protein |
Species Aquifex aeolicus [TaxId:63363] [193801] (5 PDB entries) |
Domain d3ztsk_: 3zts K: [218514] automated match to d3ztoa_ |
PDB Entry: 3zts (more details), 2.3 Å
SCOPe Domain Sequences for d3ztsk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ztsk_ d.58.6.0 (K:) automated matches {Aquifex aeolicus [TaxId: 63363]} avertliivkpdamekgalgkildrfiqegfqikalkmfrftpekagefyyvhrerpffq elvefmssgpvvaavlegedaikrvreiigptdseearkvapnsiraqfgtdkgknaiha sdspesaqyeicfifsgleiv
Timeline for d3ztsk_: