Lineage for d1deda1 (1ded A:497-582)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9616Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species)
  7. 9646Species Bacillus sp., strain 1011 [TaxId:1409] [49219] (3 PDB entries)
  8. 9651Domain d1deda1: 1ded A:497-582 [21850]
    Other proteins in same PDB: d1deda2, d1deda3, d1deda4, d1dedb2, d1dedb3, d1dedb4

Details for d1deda1

PDB Entry: 1ded (more details), 2 Å

PDB Description: crystal structure of alkalophilic asparagine 233-replaced cyclodextrin glucanotransferase complexed with an inhibitor, acarbose, at 2.0 a resolution

SCOP Domain Sequences for d1deda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deda1 b.1.1.5 (A:497-582) Cyclodextrin glycosyltransferase, domain E {Bacillus sp., strain 1011}
ttpiignvgpmmakpgvtitidgrgfgsgkgtvyfgttavtgadivawedtqiqvkipav
pggiydirvanaagaasniydnfevl

SCOP Domain Coordinates for d1deda1:

Click to download the PDB-style file with coordinates for d1deda1.
(The format of our PDB-style files is described here.)

Timeline for d1deda1: