![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.3: VHL [49468] (1 family) ![]() automatically mapped to Pfam PF01847 |
![]() | Family b.3.3.1: VHL [49469] (2 proteins) |
![]() | Protein VHL [49470] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
![]() | Domain d3ztdf_: 3ztd F: [218475] Other proteins in same PDB: d3ztda_, d3ztdb_, d3ztdd_, d3ztde_, d3ztdg_, d3ztdh_, d3ztdj_, d3ztdk_ automated match to d1lqbc_ complexed with ztd |
PDB Entry: 3ztd (more details), 2.79 Å
SCOPe Domain Sequences for d3ztdf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ztdf_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]} lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr slyedledhpnvqkdlerltqe
Timeline for d3ztdf_: