| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
| Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
| Protein Elongin C [54699] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54700] (30 PDB entries) |
| Domain d3ztdb_: 3ztd B: [218471] Other proteins in same PDB: d3ztda_, d3ztdc_, d3ztdd_, d3ztdf_, d3ztdg_, d3ztdi_, d3ztdj_, d3ztdl_ automated match to d2c9wc_ complexed with ztd |
PDB Entry: 3ztd (more details), 2.79 Å
SCOPe Domain Sequences for d3ztdb_:
Sequence, based on SEQRES records: (download)
>d3ztdb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc
>d3ztdb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns
steipefpiapeialellmaanfldc
Timeline for d3ztdb_: